SCOPe 2.06: Domain d4gqyd_: 4gqy D:

Lineage for d4gqyd_ (4gqy D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (14 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries)

8. Domain d4gqyd_: 4gqy D: [234491]
   automated match to d4gqya_
   complexed with amp

Details for d4gqyd_

PDB Entry: 4gqy, 2.19 Å

PDB Description: Crystal structure of CBSX2 in complex with AMP

PDB Compounds: (D:) CBS domain-containing protein CBSX2, chloroplastic

SCOPe Domain Sequences for d4gqyd_:

Sequence, based on SEQRES records:

>d4gqyd_ d.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald
sisgrsqndtnlfpdvdstwktfnelqklisktygkvvgdlmtpsplvvrdstnledaar
llletkfrrlpvvdadgkligiltrgnvvraalqikr

Sequence, based on observed residues (ATOM records):

>d4gqyd_ d.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald
nelqklisktygkvvgdlmtpsplvvrdstnledaarllletkfrrlpvvdadgkligil
trgnvvraalqikr

Timeline for d4gqyd_:

• d4gqyd_ first appeared in SCOPe 2.03
  
• d4gqyd_ appears in SCOPe 2.05
  
• d4gqyd_ appears in SCOPe 2.07
  
• d4gqyd_ appears in the current release, SCOPe 2.08