Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (14 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries) |
Domain d4gqyd_: 4gqy D: [234491] automated match to d4gqya_ complexed with amp |
PDB Entry: 4gqy (more details), 2.19 Å
SCOPe Domain Sequences for d4gqyd_:
Sequence, based on SEQRES records: (download)
>d4gqyd_ d.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald sisgrsqndtnlfpdvdstwktfnelqklisktygkvvgdlmtpsplvvrdstnledaar llletkfrrlpvvdadgkligiltrgnvvraalqikr
>d4gqyd_ d.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald nelqklisktygkvvgdlmtpsplvvrdstnledaarllletkfrrlpvvdadgkligil trgnvvraalqikr
Timeline for d4gqyd_: