Lineage for d4gqyd_ (4gqy D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943453Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2943454Protein automated matches [191100] (15 species)
    not a true protein
  7. 2943529Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries)
  8. 2943535Domain d4gqyd_: 4gqy D: [234491]
    automated match to d4gqya_
    complexed with amp

Details for d4gqyd_

PDB Entry: 4gqy (more details), 2.19 Å

PDB Description: Crystal structure of CBSX2 in complex with AMP
PDB Compounds: (D:) CBS domain-containing protein CBSX2, chloroplastic

SCOPe Domain Sequences for d4gqyd_:

Sequence, based on SEQRES records: (download)

>d4gqyd_ d.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald
sisgrsqndtnlfpdvdstwktfnelqklisktygkvvgdlmtpsplvvrdstnledaar
llletkfrrlpvvdadgkligiltrgnvvraalqikr

Sequence, based on observed residues (ATOM records): (download)

>d4gqyd_ d.37.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald
nelqklisktygkvvgdlmtpsplvvrdstnledaarllletkfrrlpvvdadgkligil
trgnvvraalqikr

SCOPe Domain Coordinates for d4gqyd_:

Click to download the PDB-style file with coordinates for d4gqyd_.
(The format of our PDB-style files is described here.)

Timeline for d4gqyd_: