Lineage for d4gqwa_ (4gqw A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167576Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2167577Protein automated matches [191100] (14 species)
    not a true protein
  7. 2167636Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries)
  8. 2167643Domain d4gqwa_: 4gqw A: [234489]
    automated match to d4gqya_

Details for d4gqwa_

PDB Entry: 4gqw (more details), 2.2 Å

PDB Description: Crystal structure of CBS-pair protein, CBSX1 (loop deletion) from Arabidopsis thaliana
PDB Compounds: (A:) CBS domain-containing protein CBSX1, chloroplastic

SCOPe Domain Sequences for d4gqwa_:

Sequence, based on SEQRES records: (download)

>d4gqwa_ d.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal
dsgdstwktfnavqkllsktngklvgdlmtpaplvveektnledaakilletkyrrlpvv
dsdgklvgiitrgnvvraalq

Sequence, based on observed residues (ATOM records): (download)

>d4gqwa_ d.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal
dtwktfnavqklgklvgdlmtpaplvveektnledaakilletkyrrlpvvdsdgklvgi
itrgnvvraalq

SCOPe Domain Coordinates for d4gqwa_:

Click to download the PDB-style file with coordinates for d4gqwa_.
(The format of our PDB-style files is described here.)

Timeline for d4gqwa_: