SCOPe 2.05: Domain d4gnra_: 4gnr A:

Lineage for d4gnra_ (4gnr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (60 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:637987] [234486] (1 PDB entry)

8. Domain d4gnra_: 4gnr A: [234487]
   automated match to d4mlca_
   complexed with cl, ile, mg

Details for d4gnra_

PDB Entry: 4gnr, 1 Å

PDB Description: 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. canada mdr_19a in complex with isoleucine

PDB Compounds: (A:) ABC transporter substrate-binding protein-branched chain amino acid transport

SCOPe Domain Sequences for d4gnra_:

Sequence; same for both SEQRES and ATOM records:

>d4gnra_ c.93.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
ktikigfnfeesgslaaygtaeqkgaqlavdeinaaggidgkqievvdkdnksetaeaas
vttnlvtqskvsavvgpatsgataaavanatkagvplispsatqdgltkgqdylfigtfq
dsfqgkiisnyvseklnakkvvlytdnasdyakgiaksfresykgeivadetfvagdtdf
qaaltkmkgkdfdaivvpgyyneagkivnqargmgidkpivggdgfngeefvqqataeka
sniyfisgfsttvevsakakafldayrakyneepstfaalaydsvhlvanaakgaknsge
ikdnlaktkdfegvtgqtsfdadhntvktaymmtmnngkveaaevvkp

Timeline for d4gnra_:

• d4gnra_ first appeared in SCOPe 2.03
  
• d4gnra_ appears in SCOPe 2.04
  
• d4gnra_ appears in SCOPe 2.06
  
• d4gnra_ appears in the current release, SCOPe 2.08