Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (60 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:637987] [234486] (1 PDB entry) |
Domain d4gnra_: 4gnr A: [234487] automated match to d4mlca_ complexed with cl, ile, mg |
PDB Entry: 4gnr (more details), 1 Å
SCOPe Domain Sequences for d4gnra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gnra_ c.93.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]} ktikigfnfeesgslaaygtaeqkgaqlavdeinaaggidgkqievvdkdnksetaeaas vttnlvtqskvsavvgpatsgataaavanatkagvplispsatqdgltkgqdylfigtfq dsfqgkiisnyvseklnakkvvlytdnasdyakgiaksfresykgeivadetfvagdtdf qaaltkmkgkdfdaivvpgyyneagkivnqargmgidkpivggdgfngeefvqqataeka sniyfisgfsttvevsakakafldayrakyneepstfaalaydsvhlvanaakgaknsge ikdnlaktkdfegvtgqtsfdadhntvktaymmtmnngkveaaevvkp
Timeline for d4gnra_: