SCOPe 2.04: Domain d4gjsb_: 4gjs B:

Lineage for d4gjsb_ (4gjs B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (30 PDB entries)

8. Domain d4gjsb_: 4gjs B: [234479]
   automated match to d4bx5a_
   complexed with 0od, rh

Details for d4gjsb_

PDB Entry: 4gjs, 1.85 Å

PDB Description: Streptavidin-K121H

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4gjsb_:

Sequence; same for both SEQRES and ATOM records:

>d4gjsb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawhstlvghdtftk
vk

Timeline for d4gjsb_:

• d4gjsb_ first appeared in SCOPe 2.03
  
• d4gjsb_ appears in SCOPe 2.05
  
• d4gjsb_ appears in the current release, SCOPe 2.08, called d4gjsb1