Lineage for d4gjhb_ (4gjh B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773417Family b.8.1.0: automated matches [227285] (1 protein)
    not a true family
  6. 2773418Protein automated matches [227102] (2 species)
    not a true protein
  7. 2773426Species Mouse (Mus musculus) [TaxId:10090] [226532] (1 PDB entry)
  8. 2773428Domain d4gjhb_: 4gjh B: [234477]
    automated match to d4gjha_

Details for d4gjhb_

PDB Entry: 4gjh (more details), 2.81 Å

PDB Description: Crystal Structure of the TRAF domain of TRAF5
PDB Compounds: (B:) TNF receptor-associated factor 5

SCOPe Domain Sequences for d4gjhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gjhb_ b.8.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ihkaqlnkneerfkqlegacysgkliwkvtdyrvkkreaveghtvsvfsqpfytsrcgyr
lcaraylngdgsgkgthlslyfvvmrgefdsllqwpfrqrvtlmlldqsgkknhivetfk
adpnsssfkrpdgemniasgcprfvshstlenskntyikddtlflkvavdltdled

SCOPe Domain Coordinates for d4gjhb_:

Click to download the PDB-style file with coordinates for d4gjhb_.
(The format of our PDB-style files is described here.)

Timeline for d4gjhb_: