Lineage for d4ggzd_ (4ggz D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415932Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2415933Protein automated matches [190537] (10 species)
    not a true protein
  7. 2415947Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries)
  8. 2415951Domain d4ggzd_: 4ggz D: [234475]
    automated match to d4jnja_
    complexed with btn

Details for d4ggzd_

PDB Entry: 4ggz (more details), 1.75 Å

PDB Description: The structure of bradavidin2-biotin complex
PDB Compounds: (D:) Bradavidin 2

SCOPe Domain Sequences for d4ggzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggzd_ b.61.1.0 (D:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw

SCOPe Domain Coordinates for d4ggzd_:

Click to download the PDB-style file with coordinates for d4ggzd_.
(The format of our PDB-style files is described here.)

Timeline for d4ggzd_: