SCOPe 2.06: Domain d4ggtb_: 4ggt B:

Lineage for d4ggtb_ (4ggt B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries)

8. Domain d4ggtb_: 4ggt B: [234472]
   automated match to d4jnja_

Details for d4ggtb_

PDB Entry: 4ggt, 1.69 Å

PDB Description: Structure of apo Bradavidin2 (Form B)

PDB Compounds: (B:) Bradavidin 2

SCOPe Domain Sequences for d4ggtb_:

Sequence; same for both SEQRES and ATOM records:

>d4ggtb_ b.61.1.0 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw

Timeline for d4ggtb_:

• d4ggtb_ first appeared in SCOPe 2.03
  
• d4ggtb_ appears in SCOPe 2.05
  
• d4ggtb_ appears in SCOPe 2.07
  
• d4ggtb_ appears in the current release, SCOPe 2.08