![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Plasmodium knowlesi [TaxId:5851] [234464] (1 PDB entry) |
![]() | Domain d4ggna_: 4ggn A: [234466] automated match to d1ggwa_ |
PDB Entry: 4ggn (more details), 2.29 Å
SCOPe Domain Sequences for d4ggna_:
Sequence, based on SEQRES records: (download)
>d4ggna_ a.39.1.0 (A:) automated matches {Plasmodium knowlesi [TaxId: 5851]} kdmfntkssngklriedashnarklglapsstdekkirdlygdsltyeqyleyltmcvhd rdnmeelikmfshfdnnssgfltknqmknilttwgdalteqeandalnafssedrinykl fcedils
>d4ggna_ a.39.1.0 (A:) automated matches {Plasmodium knowlesi [TaxId: 5851]} kdmfntkssklriedashnarklglapsstdekkirdlygdsltyeqyleyltmcvhdrd nmeelikmfshfdnnssgfltknqmknilttwgdalteqeandalnafssedrinyklfc edils
Timeline for d4ggna_: