Lineage for d4gena1 (4gen A:89-241)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977836Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2977837Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2978070Family d.136.1.0: automated matches [194358] (1 protein)
    not a true family
  6. 2978071Protein automated matches [194381] (1 species)
    not a true protein
  7. 2978072Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [194383] (2 PDB entries)
  8. 2978074Domain d4gena1: 4gen A:89-241 [234463]
    Other proteins in same PDB: d4gena2
    automated match to d4h4aa_
    complexed with cl

Details for d4gena1

PDB Entry: 4gen (more details), 2.2 Å

PDB Description: crystal structure of zucchini (monomer)
PDB Compounds: (A:) Mitochondrial cardiolipin hydrolase

SCOPe Domain Sequences for d4gena1:

Sequence, based on SEQRES records: (download)

>d4gena1 d.136.1.0 (A:89-241) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slrnvakiveqidravysidlaiytftslfladsikralqrgviiriisdgemvyskgsq
ismlaqlgvpvrvpittnlmhnkfciidgferveeirllrklkfmrpcysivisgsvnwt
alglggnwenciitaddkltatfqaefqrmwra

Sequence, based on observed residues (ATOM records): (download)

>d4gena1 d.136.1.0 (A:89-241) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slrnvakiveqidravysidlaiytftslfladsikralqrgviiriisdgemvyskgsq
ismlaqlgvpvrvpittnlmhnkfciidgferveeirllrklkfmrpcysivisgsvnwt
gnwenciitaddkltatfqaefqrmwra

SCOPe Domain Coordinates for d4gena1:

Click to download the PDB-style file with coordinates for d4gena1.
(The format of our PDB-style files is described here.)

Timeline for d4gena1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gena2