SCOPe 2.07: Domain d4gb2a_: 4gb2 A:

Lineage for d4gb2a_ (4gb2 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)

8. Domain d4gb2a_: 4gb2 A: [234460]
   automated match to d1mrwa_
   complexed with 0lq, cl, gol; mutant

Details for d4gb2a_

PDB Entry: 4gb2, 1.79 Å

PDB Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a bicyclic pyrrolidine inhibitor

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4gb2a_:

Sequence; same for both SEQRES and ATOM records:

>d4gb2a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d4gb2a_:

• d4gb2a_ first appeared in SCOPe 2.03
  
• d4gb2a_ appears in SCOPe 2.06
  
• d4gb2a_ appears in the current release, SCOPe 2.08