Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries) |
Domain d4gb2b_: 4gb2 B: [234459] automated match to d1mrwa_ complexed with 0lq, cl, gol; mutant |
PDB Entry: 4gb2 (more details), 1.79 Å
SCOPe Domain Sequences for d4gb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gb2b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d4gb2b_: