SCOPe 2.06: Domain d4g9oa1: 4g9o A:1-252

Lineage for d4g9oa1 (4g9o A:1-252)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)

8. Domain d4g9oa1: 4g9o A:1-252 [234456]
   Other proteins in same PDB: d4g9oa2
   automated match to d2v4na_
   complexed with edo, mg; mutant

Details for d4g9oa1

PDB Entry: 4g9o, 2.12 Å

PDB Description: Crystal Structure of H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium

PDB Compounds: (A:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4g9oa1:

Sequence, based on SEQRES records:

>d4g9oa1 c.106.1.0 (A:1-252) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdvv
sdwldsvgvgtq

Sequence, based on observed residues (ATOM records):

>d4g9oa1 c.106.1.0 (A:1-252) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigpdtdfaavdegyvsvtplhvdltaasahdvvsdwldsvgv
gtq

Timeline for d4g9oa1:

• d4g9oa1 first appeared in SCOPe 2.03, called d4g9oa_
  
• d4g9oa1 was called d4g9oa_ in SCOPe 2.05
  
• d4g9oa1 appears in SCOPe 2.07
  
• d4g9oa1 appears in the current release, SCOPe 2.08