Lineage for d4g9ob_ (4g9o B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148432Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2148433Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2148449Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2148450Protein automated matches [190619] (7 species)
    not a true protein
  7. 2148469Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)
  8. 2148477Domain d4g9ob_: 4g9o B: [234455]
    Other proteins in same PDB: d4g9oa2
    automated match to d2v4na_
    complexed with edo, mg; mutant

Details for d4g9ob_

PDB Entry: 4g9o (more details), 2.12 Å

PDB Description: Crystal Structure of H234A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium
PDB Compounds: (B:) 5'/3'-nucleotidase SurE

SCOPe Domain Sequences for d4g9ob_:

Sequence, based on SEQRES records: (download)

>d4g9ob_ c.106.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdvv
sdwldsvgvgtqw

Sequence, based on observed residues (ATOM records): (download)

>d4g9ob_ c.106.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
lavslngyqhydtaaavtcallrglsrepltgrilnvnvpdlplaqvkgirvtrcgsrhp
adkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltaasahdvvs
dwldsvgvgtqw

SCOPe Domain Coordinates for d4g9ob_:

Click to download the PDB-style file with coordinates for d4g9ob_.
(The format of our PDB-style files is described here.)

Timeline for d4g9ob_: