SCOPe 2.08: Domain d4g7sa_: 4g7s A:

Lineage for d4g7sa_ (4g7s A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)

8. Domain d4g7sa_: 4g7s A: [234454]
   Other proteins in same PDB: d4g7sb1, d4g7sb2, d4g7sc_
   automated match to d1xmea_
   complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g7sa_

PDB Entry: 4g7s, 2 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236I from Thermus thermophilus

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d4g7sa_:

Sequence; same for both SEQRES and ATOM records:

>d4g7sa_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllane
atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpiiyfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

Timeline for d4g7sa_:

• d4g7sa_ first appeared in SCOPe 2.03
  
• d4g7sa_ appears in SCOPe 2.07