Lineage for d4g78a_ (4g78 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1483413Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1483913Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 1483974Family a.24.10.0: automated matches [227273] (1 protein)
    not a true family
  6. 1483975Protein automated matches [227077] (2 species)
    not a true protein
  7. 1483976Species Medicago truncatula [TaxId:3880] [226282] (2 PDB entries)
  8. 1483977Domain d4g78a_: 4g78 A: [234452]
    automated match to d3us6a_

Details for d4g78a_

PDB Entry: 4g78 (more details), 0.92 Å

PDB Description: Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula
PDB Compounds: (A:) Histidine phosphotransfer protein

SCOPe Domain Sequences for d4g78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g78a_ a.24.10.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
snamdhlhrklrdheaamfqqgylddqfsqlqklqddtspdfvievmtmffddsekllnn
msraleqvpvnfkqidahahqqkgssasvgaarvknvcgtfrnfceaqnlegcvrclqql
qqeysllknnlkylfklqqeiktagrs

SCOPe Domain Coordinates for d4g78a_:

Click to download the PDB-style file with coordinates for d4g78a_.
(The format of our PDB-style files is described here.)

Timeline for d4g78a_: