SCOPe 2.03: Domain d4g78a_: 4g78 A:

Lineage for d4g78a_ (4g78 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.0: automated matches [227273] (1 protein)
   not a true family

6. Protein automated matches [227077] (2 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [226282] (2 PDB entries)

8. Domain d4g78a_: 4g78 A: [234452]
   automated match to d3us6a_

Details for d4g78a_

PDB Entry: 4g78, 0.92 Å

PDB Description: Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula

PDB Compounds: (A:) Histidine phosphotransfer protein

SCOPe Domain Sequences for d4g78a_:

Sequence; same for both SEQRES and ATOM records:

>d4g78a_ a.24.10.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
snamdhlhrklrdheaamfqqgylddqfsqlqklqddtspdfvievmtmffddsekllnn
msraleqvpvnfkqidahahqqkgssasvgaarvknvcgtfrnfceaqnlegcvrclqql
qqeysllknnlkylfklqqeiktagrs

Timeline for d4g78a_:

• d4g78a_ is new in SCOPe 2.03-stable
  
• d4g78a_ appears in SCOPe 2.04
  
• d4g78a_ appears in the current release, SCOPe 2.08, called d4g78a1