![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) ![]() contains additional, fifth helix at the N-terminus |
![]() | Family a.24.10.0: automated matches [227273] (1 protein) not a true family |
![]() | Protein automated matches [227077] (2 species) not a true protein |
![]() | Species Medicago truncatula [TaxId:3880] [226282] (2 PDB entries) |
![]() | Domain d4g78a1: 4g78 A:1-144 [234452] Other proteins in same PDB: d4g78a2 automated match to d3us6a_ |
PDB Entry: 4g78 (more details), 0.92 Å
SCOPe Domain Sequences for d4g78a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g78a1 a.24.10.0 (A:1-144) automated matches {Medicago truncatula [TaxId: 3880]} mdhlhrklrdheaamfqqgylddqfsqlqklqddtspdfvievmtmffddsekllnnmsr aleqvpvnfkqidahahqqkgssasvgaarvknvcgtfrnfceaqnlegcvrclqqlqqe ysllknnlkylfklqqeiktagrs
Timeline for d4g78a1: