Lineage for d4g6ba_ (4g6b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330826Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2330827Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2330828Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2330829Protein Citrate synthase [48258] (7 species)
  7. 2330849Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
    Uniprot P00891
  8. 2330862Domain d4g6ba_: 4g6b A: [234449]
    automated match to d4g6bb_
    complexed with so4

Details for d4g6ba_

PDB Entry: 4g6b (more details), 2.2 Å

PDB Description: Three dimensional structure analysis of the type II citrate synthase from e.coli
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d4g6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g6ba_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltldgdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipefvrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d4g6ba_:

Click to download the PDB-style file with coordinates for d4g6ba_.
(The format of our PDB-style files is described here.)

Timeline for d4g6ba_: