SCOPe 2.08: Domain d4g59a_: 4g59 A:

Lineage for d4g59a_ (4g59 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d4g59a_: 4g59 A: [234445]
   automated match to d1kcgc_
   complexed with nag

Details for d4g59a_

PDB Entry: 4g59, 2.44 Å

PDB Description: crystal structure of the murine cytomegalovirus mhc-i homolog m152 with ligand rae-1 gamma

PDB Compounds: (A:) Retinoic acid early-inducible protein 1-gamma

SCOPe Domain Sequences for d4g59a_:

Sequence, based on SEQRES records:

>d4g59a_ d.19.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ahslrcnltikaptpadplwyeakclvdeililhlsninktmtsgdpgetanatevgecl
tqpvndlcqklrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfft
fytenmswrsandesgvimnkwnddgdlvqrlkyfipecrqkideflkqske

Sequence, based on observed residues (ATOM records):

>d4g59a_ d.19.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ahslrcnltikaptpadplwyeakclvdeililhlsninkanatevgecltqpvndlcqk
lrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfftfytenmswrs
andesgvimnkwnddgdlvqrlkyfipecrqkideflkqske

Timeline for d4g59a_:

• d4g59a_ first appeared in SCOPe 2.03
  
• d4g59a_ appears in SCOPe 2.07