Lineage for d4g4pa1 (4g4p A:21-244)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163744Species Enterococcus faecalis [TaxId:226185] [195543] (5 PDB entries)
  8. 2163745Domain d4g4pa1: 4g4p A:21-244 [234444]
    Other proteins in same PDB: d4g4pa2
    automated match to d2y7ia_
    complexed with gln, mes

Details for d4g4pa1

PDB Entry: 4g4p (more details), 1.5 Å

PDB Description: Crystal structure of glutamine-binding protein from Enterococcus faecalis at 1.5 A
PDB Compounds: (A:) Amino acid ABC transporter, amino acid-binding/permease protein

SCOPe Domain Sequences for d4g4pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4pa1 c.94.1.0 (A:21-244) automated matches {Enterococcus faecalis [TaxId: 226185]}
egkkytigtdltfapfefqdskgkyigidvdlldaiakdqdfevdlkplgfdsavqaiqs
kqidgmiagmsitderkksfdfsdpyfdsglqlavkkgndkiksyddlkgktvaakvgte
sanfleknkekydytiknfddatglykalengeadaivddypvlgyavkngqklqlvgdk
etgssygfavkkgqnpelikkfnaglknlkdngtydkilnnyla

SCOPe Domain Coordinates for d4g4pa1:

Click to download the PDB-style file with coordinates for d4g4pa1.
(The format of our PDB-style files is described here.)

Timeline for d4g4pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g4pa2