Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [195543] (5 PDB entries) |
Domain d4g4pa1: 4g4p A:21-244 [234444] Other proteins in same PDB: d4g4pa2 automated match to d2y7ia_ complexed with gln, mes |
PDB Entry: 4g4p (more details), 1.5 Å
SCOPe Domain Sequences for d4g4pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g4pa1 c.94.1.0 (A:21-244) automated matches {Enterococcus faecalis [TaxId: 226185]} egkkytigtdltfapfefqdskgkyigidvdlldaiakdqdfevdlkplgfdsavqaiqs kqidgmiagmsitderkksfdfsdpyfdsglqlavkkgndkiksyddlkgktvaakvgte sanfleknkekydytiknfddatglykalengeadaivddypvlgyavkngqklqlvgdk etgssygfavkkgqnpelikkfnaglknlkdngtydkilnnyla
Timeline for d4g4pa1: