SCOPe 2.08: Domain d4g28b1: 4g28 B:396-487

Lineage for d4g28b1 (4g28 B:396-487)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)

6. Protein Small-conductance potassium channel [64528] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)

8. Domain d4g28b1: 4g28 B:396-487 [234443]
   Other proteins in same PDB: d4g28b2, d4g28b3, d4g28r_
   automated match to d4j9zb_
   complexed with 0w8, ca, gol, so4

Details for d4g28b1

PDB Entry: 4g28, 1.63 Å

PDB Description: calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1

PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d4g28b1:

Sequence, based on SEQRES records:

>d4g28b1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
flqaihqlrsvkmeqrklndqantlvdlaktq

Sequence, based on observed residues (ATOM records):

>d4g28b1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkleltkaedtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihql
rsvkmeqrklndqantlvdlaktq

Timeline for d4g28b1:

• d4g28b1 first appeared in SCOPe 2.03, called d4g28b_
  
• d4g28b1 appears in SCOPe 2.07