Lineage for d4g05a_ (4g05 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (13 species)
    not a true protein
  7. 2329057Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2329072Domain d4g05a_: 4g05 A: [234441]
    automated match to d4fcna_
    complexed with ca, hem, jz3, so4; mutant

Details for d4g05a_

PDB Entry: 4g05 (more details), 2.35 Å

PDB Description: The crystal structures of several mutants of Pleurotus eryngii versatile peroxidase
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d4g05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g05a_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpalta

SCOPe Domain Coordinates for d4g05a_:

Click to download the PDB-style file with coordinates for d4g05a_.
(The format of our PDB-style files is described here.)

Timeline for d4g05a_: