SCOPe 2.06: Domain d4fzwb1: 4fzw B:1-255

Lineage for d4fzwb1 (4fzw B:1-255)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries)

8. Domain d4fzwb1: 4fzw B:1-255 [234439]
   Other proteins in same PDB: d4fzwb2
   automated match to d3qxia_
   complexed with gol

Details for d4fzwb1

PDB Entry: 4fzw, 2.55 Å

PDB Description: crystal structure of the paaf-paag hydratase-isomerase complex from e.coli

PDB Compounds: (B:) 2,3-dehydroadipyl-CoA hydratase

SCOPe Domain Sequences for d4fzwb1:

Sequence; same for both SEQRES and ATOM records:

>d4fzwb1 c.14.1.0 (B:1-255) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mselivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnarffa
agadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvvvag
enarfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdvfps
dltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedrheg
isaflqkrtpdfkgr

Timeline for d4fzwb1:

• d4fzwb1 first appeared in SCOPe 2.03, called d4fzwb_
  
• d4fzwb1 was called d4fzwb_ in SCOPe 2.05
  
• d4fzwb1 appears in SCOPe 2.07
  
• d4fzwb1 appears in the current release, SCOPe 2.08