| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.11: AF1782-like [158372] (1 family) ![]() automatically mapped to Pfam PF04010 |
| Family a.8.11.1: AF1782-like [158373] (3 proteins) Pfam PF04010; DUF357 |
| Protein automated matches [229582] (1 species) not a true protein |
| Species Methanothermobacter thermautotrophicus [TaxId:187420] [229583] (2 PDB entries) |
| Domain d4fzpa1: 4fzp A:2-77 [234437] Other proteins in same PDB: d4fzpa2, d4fzpa3, d4fzpb2, d4fzpb3 automated match to d4fzoa_ complexed with ium |
PDB Entry: 4fzp (more details), 1.29 Å
SCOPe Domain Sequences for d4fzpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fzpa1 a.8.11.1 (A:2-77) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsfgcit
yaegltdslrmlhrii
Timeline for d4fzpa1: