Lineage for d4fzib_ (4fzi B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081489Species Trypanosoma cruzi [TaxId:353153] [226444] (2 PDB entries)
  8. 2081492Domain d4fzib_: 4fzi B: [234436]
    automated match to d4giea_
    complexed with glu, so4

Details for d4fzib_

PDB Entry: 4fzi (more details), 2.6 Å

PDB Description: crystal structure of prostaglandin f synthase from trypanosoma cruzi
PDB Compounds: (B:) prostaglandin F synthase

SCOPe Domain Sequences for d4fzib_:

Sequence, based on SEQRES records: (download)

>d4fzib_ c.1.7.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
yncvtlhnsvrmpqlglgvwraqdgaetanavrwaieagyrhidtayiysnergvgqgir
esgvpreevwvttkvwnsdqgyektlaafersrellgleyidlylihwpgkkkfvdtwka
leklyeekkvraigvsnfephhltelfksckirpmvnqvelhplfqqrtlrefckqhnia
itawsplgsgeeagilknhvlgeiakkhnkspaqvvirwdiqhgivtipkstnkgriqen
fnvwdfklteeemrqidelnedkrigadpdnffpgg

Sequence, based on observed residues (ATOM records): (download)

>d4fzib_ c.1.7.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
yncvtlhnsvrmpqlglgvwraqdgaetanavrwaieagyrhidtayiysnergvgqgir
esgvpreevwvttkvwnsdqgyektlaafersrellgleyidlylihwpgkkkfvdtwka
leklyeekkvraigvsnfephhltelfksckirpmvnqvelhplfqqrtlrefckqhnia
itawsplgsilknhvlgeiakkhnkspaqvvirwdiqhgivtipkstnkgriqenfnvwd
fklteeemrqidelnedkrigadpdnffpgg

SCOPe Domain Coordinates for d4fzib_:

Click to download the PDB-style file with coordinates for d4fzib_.
(The format of our PDB-style files is described here.)

Timeline for d4fzib_: