![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
![]() | Protein automated matches [190340] (5 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187944] (2 PDB entries) |
![]() | Domain d4fxyp_: 4fxy P: [234434] automated match to d4fxyq_ complexed with 0w2, zn |
PDB Entry: 4fxy (more details), 2.8 Å
SCOPe Domain Sequences for d4fxyp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fxyp_ d.92.1.5 (P:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ssytaagrnvlrwdlspeqiktrteqliaqtkqvydtvgtialkevtyenclqvladiev tyivertmldfpqhvssdrevraasteadkklsrfdiemsmredvfqrivhlqetcdlek ikpearryleksikmgkrnglhlseairneiksmkkrmselcidfnknlneddtslvfsk aelgalpddfidslektdedkykvtlkyphyfpvmkkccvpetrrkmemafhtrckqent ailqqllplraqvakllgynthadfvlelntakstsrvaaflddlsqklkplgeaerefi lslkkkeceergfeydgkinawdlhyymtqteelkysvdqeslkeyfpievvtegllsiy qellglsfeqvpdahvwnksvslytvkdkatgevlgqfyldlypregkynhaacfglqpg cllpdgsrmmsvaalvvnfsqpvagrpsllrhdevrtyfhefghvmhqicaqtdfarfsg tnvetdfvevpsqmlenwvwdvdslrklskhykdghpitdelleklvasrlvntglltlr qivlskvdqslhtnatldaaseyakycteilgvaatpgtnmpatfghlaggydgqyygyl wsevfsmdmfhscfkkegimnpevgmkyrnlilkpggsldgmdmlqnflqrepnqkaflm srgl
Timeline for d4fxyp_: