SCOPe 2.08: Domain d4fsfa1: 4fsf A:53-221

Lineage for d4fsfa1 (4fsf A:53-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)

8. Domain d4fsfa1: 4fsf A:53-221 [234431]
   Other proteins in same PDB: d4fsfa2
   automated match to d4kqoa1
   complexed with 0w0

Details for d4fsfa1

PDB Entry: 4fsf, 2.2 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa PBP3 complexed with compound 14

PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d4fsfa1:

Sequence; same for both SEQRES and ATOM records:

>d4fsfa1 d.175.1.0 (A:53-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfad
rieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvdd
rgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Timeline for d4fsfa1:

• d4fsfa1 first appeared in SCOPe 2.03
  
• d4fsfa1 appears in SCOPe 2.07