Lineage for d1r093_ (1r09 3:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Rhinovirus coat protein [49670] (5 species) 
Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries) 
Domain d1r093_: 1r09 3: [23443]
Details for d1r093_
PDB Entry: 1r09 (more details), 2.9 Å
PDB Description: human rhinovirus 14 complexed with antiviral compound r 61837
SCOP Domain Sequences for d1r093_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r093_ b.10.1.4 (3:) Rhinovirus coat protein {Human rhinovirus 14}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
SCOP Domain Coordinates for d1r093_:
Click to download the PDB-style file with coordinates for d1r093_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r093_:
- d1r093_ appears in SCOP 1.57
- d1r093_ appears in the current release, SCOPe 2.08
View in 3D
