SCOPe 2.06: Domain d4fryb_: 4fry B:

Lineage for d4fryb_ (4fry B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (14 species)
   not a true protein

7. Species Burkholderia ambifaria [TaxId:398577] [234427] (1 PDB entry)

8. Domain d4fryb_: 4fry B: [234429]
   automated match to d2p9ma_
   complexed with amp, nad

Details for d4fryb_

PDB Entry: 4fry, 2.1 Å

PDB Description: The structure of a putative signal-transduction protein with CBS domains from Burkholderia ambifaria MC40-6

PDB Compounds: (B:) Putative signal-transduction protein with CBS domains

SCOPe Domain Sequences for d4fryb_:

Sequence; same for both SEQRES and ATOM records:

>d4fryb_ d.37.1.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
sttvaqilkakpdsgrtiytvtkndfvydaiklmaekgigallvvdgddiagivterdya
rkvvlqersskatrveeimtakvryvepsqstdecmalmtehrmrhlpvldggkliglis
igdlvksviadqqftisq

Timeline for d4fryb_:

• d4fryb_ first appeared in SCOPe 2.03
  
• d4fryb_ appears in SCOPe 2.05
  
• d4fryb_ appears in SCOPe 2.07
  
• d4fryb_ appears in the current release, SCOPe 2.08