Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Burkholderia ambifaria [TaxId:398577] [234427] (1 PDB entry) |
Domain d4fryb_: 4fry B: [234429] automated match to d2p9ma_ complexed with amp, nad |
PDB Entry: 4fry (more details), 2.1 Å
SCOPe Domain Sequences for d4fryb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fryb_ d.37.1.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]} sttvaqilkakpdsgrtiytvtkndfvydaiklmaekgigallvvdgddiagivterdya rkvvlqersskatrveeimtakvryvepsqstdecmalmtehrmrhlpvldggkliglis igdlvksviadqqftisq
Timeline for d4fryb_: