Lineage for d4fryb_ (4fry B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943453Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2943454Protein automated matches [191100] (15 species)
    not a true protein
  7. 2943485Species Burkholderia ambifaria [TaxId:398577] [234427] (1 PDB entry)
  8. 2943487Domain d4fryb_: 4fry B: [234429]
    automated match to d2p9ma_
    complexed with amp, nad

Details for d4fryb_

PDB Entry: 4fry (more details), 2.1 Å

PDB Description: The structure of a putative signal-transduction protein with CBS domains from Burkholderia ambifaria MC40-6
PDB Compounds: (B:) Putative signal-transduction protein with CBS domains

SCOPe Domain Sequences for d4fryb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fryb_ d.37.1.0 (B:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
sttvaqilkakpdsgrtiytvtkndfvydaiklmaekgigallvvdgddiagivterdya
rkvvlqersskatrveeimtakvryvepsqstdecmalmtehrmrhlpvldggkliglis
igdlvksviadqqftisq

SCOPe Domain Coordinates for d4fryb_:

Click to download the PDB-style file with coordinates for d4fryb_.
(The format of our PDB-style files is described here.)

Timeline for d4fryb_: