Lineage for d4fgwa2 (4fgw A:235-385)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276612Species Saccharomyces cerevisiae [TaxId:559292] [234425] (1 PDB entry)
  8. 1276613Domain d4fgwa2: 4fgw A:235-385 [234426]
    Other proteins in same PDB: d4fgwa1
    automated match to d1x0xa2

Details for d4fgwa2

PDB Entry: 4fgw (more details), 2.45 Å

PDB Description: Structure of Glycerol-3-Phosphate Dehydrogenase, GPD1, from Sacharomyces Cerevisiae
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD(+)] 1

SCOPe Domain Sequences for d4fgwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fgwa2 a.100.1.0 (A:235-385) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
vagisicgalknvvalgcgfveglgwgnnasaaiqrvglgeiirfgqmffpesreetyyq
esagvadlittcaggrnvkvarlmatsgkdawecekellngqsaqglitckevhewletc
gsvedfplfeavyqivynnypmknlpdmiee

SCOPe Domain Coordinates for d4fgwa2:

Click to download the PDB-style file with coordinates for d4fgwa2.
(The format of our PDB-style files is described here.)

Timeline for d4fgwa2: