Lineage for d4fefa_ (4fef A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720844Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2720855Domain d4fefa_: 4fef A: [234422]
    automated match to d4fcna_
    complexed with ca, gol, hem, so4; mutant

Details for d4fefa_

PDB Entry: 4fef (more details), 2 Å

PDB Description: The crystal structures of several mutants of pleurotus eryngii versatile peroxidase
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d4fefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fefa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpegfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpal

SCOPe Domain Coordinates for d4fefa_:

Click to download the PDB-style file with coordinates for d4fefa_.
(The format of our PDB-style files is described here.)

Timeline for d4fefa_: