Lineage for d4fdqa_ (4fdq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (13 species)
    not a true protein
  7. 2329057Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2329063Domain d4fdqa_: 4fdq A: [234421]
    automated match to d4fcna_
    complexed with ca, gol, hem, so4; mutant

Details for d4fdqa_

PDB Entry: 4fdq (more details), 1.6 Å

PDB Description: The crystal structures of several mutants of pleurotus eryngii versatile peroxidase
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d4fdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fdqa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpal

SCOPe Domain Coordinates for d4fdqa_:

Click to download the PDB-style file with coordinates for d4fdqa_.
(The format of our PDB-style files is described here.)

Timeline for d4fdqa_: