Lineage for d4fcea2 (4fce A:252-449)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814440Species Yersinia pseudotuberculosis [TaxId:214092] [234417] (1 PDB entry)
  8. 2814441Domain d4fcea2: 4fce A:252-449 [234418]
    Other proteins in same PDB: d4fcea1
    automated match to d1hv9a1
    complexed with edo, gp1, mg

Details for d4fcea2

PDB Entry: 4fce (more details), 1.96 Å

PDB Description: crystal structure of yersinia pestis glmu in complex with alpha-d- glucosamine 1-phosphate (gp1)
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4fcea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fcea2 b.81.1.0 (A:252-449) automated matches {Yersinia pseudotuberculosis [TaxId: 214092]}
vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp
ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae
igagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangatigagttvtrdv
aenelvisrvkqvhiqgw

SCOPe Domain Coordinates for d4fcea2:

Click to download the PDB-style file with coordinates for d4fcea2.
(The format of our PDB-style files is described here.)

Timeline for d4fcea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fcea1