SCOPe 2.08: Domain d4fcba1: 4fcb A:439-759

Lineage for d4fcba1 (4fcb A:439-759)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d4fcba1: 4fcb A:439-759 [234412]
   Other proteins in same PDB: d4fcba2, d4fcbb2
   automated match to d3wi2a_
   complexed with 0t7, mg, zn

Details for d4fcba1

PDB Entry: 4fcb, 2.1 Å

PDB Description: potent and selective phosphodiesterase 10a inhibitors

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4fcba1:

Sequence; same for both SEQRES and ATOM records:

>d4fcba1 a.211.1.0 (A:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

Timeline for d4fcba1:

• d4fcba1 first appeared in SCOPe 2.03, called d4fcba_
  
• d4fcba1 appears in SCOPe 2.07