SCOP 1.75: Domain d1r091_: 1r09 1:

Lineage for d1r091_ (1r09 1:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (30 PDB entries)

8. Domain d1r091_: 1r09 1: [23441]
   complexed with dms, jen

Details for d1r091_

PDB Entry: 1r09, 2.9 Å

PDB Description: human rhinovirus 14 complexed with antiviral compound r 61837

PDB Compounds: (1:) human rhinovirus 14 coat protein (subunit vp1)

SCOP Domain Sequences for d1r091_:

Sequence; same for both SEQRES and ATOM records:

>d1r091_ b.121.4.1 (1:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
apralpytsigrtnypkntepvikkrkgdiksy

Timeline for d1r091_:

• d1r091_ first appeared (with stable ids) in SCOP 1.55
  
• d1r091_ appears in SCOP 1.73
  
• d1r091_ appears in SCOPe 2.01
  
• d1r091_ appears in the current release, SCOPe 2.08