Lineage for d4ey2b_ (4ey2 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603630Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2603691Domain d4ey2b_: 4ey2 B: [234408]
    automated match to d3q6xb_
    complexed with 0rm, zn

Details for d4ey2b_

PDB Entry: 4ey2 (more details), 1.17 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed methicillin
PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4ey2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ey2b_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

SCOPe Domain Coordinates for d4ey2b_:

Click to download the PDB-style file with coordinates for d4ey2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ey2b_: