Lineage for d4ey2a_ (4ey2 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440394Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1440395Protein automated matches [190418] (8 species)
    not a true protein
  7. 1440403Species Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries)
  8. 1440406Domain d4ey2a_: 4ey2 A: [234407]
    automated match to d3q6xb_
    complexed with 0rm, zn

Details for d4ey2a_

PDB Entry: 4ey2 (more details), 1.17 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed methicillin
PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4ey2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ey2a_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

SCOPe Domain Coordinates for d4ey2a_:

Click to download the PDB-style file with coordinates for d4ey2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ey2a_: