| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) ![]() contains additional, fifth helix at the N-terminus |
| Family a.24.10.0: automated matches [227273] (1 protein) not a true family |
| Protein automated matches [227077] (2 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [234400] (2 PDB entries) |
| Domain d4eukb_: 4euk B: [234401] Other proteins in same PDB: d4euka_ automated match to d3us6a_ complexed with edo, mg |
PDB Entry: 4euk (more details), 1.95 Å
SCOPe Domain Sequences for d4eukb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eukb_ a.24.10.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdlvqkqkslqdytkslflegildsqflqlqqlqdesnpdfvsqvvtlffqdsdrilndl
slsldqqvvdfkkvdphvhqlkgssssigaqrvknacvvfrsfceqqnveachrclqqvk
qeyylvknrletlfkleqqivasggmipavel
Timeline for d4eukb_: