SCOPe 2.03: Domain d4ej7a_: 4ej7 A:

Lineage for d4ej7a_ (4ej7 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:509173] [227366] (7 PDB entries)

8. Domain d4ej7a_: 4ej7 A: [234392]
   automated match to d4gkig_
   complexed with atp, ca, peg

Details for d4ej7a_

PDB Entry: 4ej7, 2.29 Å

PDB Description: Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, ATP-bound

PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase AphA1-IAB

SCOPe Domain Sequences for d4ej7a_:

Sequence; same for both SEQRES and ATOM records:

>d4ej7a_ d.144.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
shiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsv
andvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgeniv
dalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwke
mhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefsp
slqkrlfqkygidnpdmnklqfhlmldeff

Timeline for d4ej7a_:

• d4ej7a_ is new in SCOPe 2.03-stable
  
• d4ej7a_ appears in SCOPe 2.04
  
• d4ej7a_ appears in the current release, SCOPe 2.08