Lineage for d4ed5b2 (4ed5 B:100-186)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952526Domain d4ed5b2: 4ed5 B:100-186 [234387]
    automated match to d1fxla2
    protein/RNA complex; complexed with edo, gol, m2m

Details for d4ed5b2

PDB Entry: 4ed5 (more details), 2 Å

PDB Description: Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
PDB Compounds: (B:) ELAV-like protein 1

SCOPe Domain Sequences for d4ed5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ed5b2 d.58.7.0 (B:100-186) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevikdanlyisglprtmtqkdvedmfsrfgriinsrvlvdqttglsrgvafirfdkrse
aeeaitsfnghkppgssepitvkfaan

SCOPe Domain Coordinates for d4ed5b2:

Click to download the PDB-style file with coordinates for d4ed5b2.
(The format of our PDB-style files is described here.)

Timeline for d4ed5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ed5b1