SCOPe 2.07: Domain d4ebca2: 4ebc A:300-414

Lineage for d4ebca2 (4ebc A:300-414)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase iota [111015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
   Uniprot Q9UNA4

8. Domain d4ebca2: 4ebc A:300-414 [234386]
   Other proteins in same PDB: d4ebca1
   automated match to d2dpia1
   protein/DNA complex; complexed with 0oh, ca, gol

Details for d4ebca2

PDB Entry: 4ebc, 2.9 Å

PDB Description: Conformationally Restrained North-methanocarba-2'-deoxyadenosine Corrects the Error-Prone Nature of Human DNA Polymerase Iota

PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d4ebca2:

Sequence, based on SEQRES records:

>d4ebca2 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records):

>d4ebca2 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdrkphtvrliirrygresrqcpips
hviqkdvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Timeline for d4ebca2:

• d4ebca2 first appeared in SCOPe 2.03
  
• d4ebca2 appears in SCOPe 2.06
  
• d4ebca2 appears in the current release, SCOPe 2.08