| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Paracoccus denitrificans [TaxId:318586] [234379] (3 PDB entries) |
| Domain d4e8ga2: 4e8g A:127-369 [234381] Other proteins in same PDB: d4e8ga1, d4e8ga3, d4e8gb1, d4e8gb3 automated match to d4mggf2 complexed with mg, unl |
PDB Entry: 4e8g (more details), 2 Å
SCOPe Domain Sequences for d4e8ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e8ga2 c.1.11.0 (A:127-369) automated matches {Paracoccus denitrificans [TaxId: 318586]}
vaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkvwerirg
tgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiyldesge
dlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdiiaaact
higatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdeslfgppva
sfs
Timeline for d4e8ga2: