Lineage for d4eeva_ (4eev A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434799Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1434800Species Human (Homo sapiens) [TaxId:9606] [103301] (34 PDB entries)
  8. 1434806Domain d4eeva_: 4eev A: [234376]
    automated match to d3r7oa_
    complexed with l1x

Details for d4eeva_

PDB Entry: 4eev (more details), 1.8 Å

PDB Description: Crystal structure of c-Met in complex with LY2801653
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d4eeva_:

Sequence, based on SEQRES records: (download)

>d4eeva_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
pllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkk
ihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgd
lrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfg
lardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappy
pdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstf
ig

Sequence, based on observed residues (ATOM records): (download)

>d4eeva_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
pllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkk
ihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgd
lrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfg
klpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrll
qpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

SCOPe Domain Coordinates for d4eeva_:

Click to download the PDB-style file with coordinates for d4eeva_.
(The format of our PDB-style files is described here.)

Timeline for d4eeva_: