![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [234364] (3 PDB entries) |
![]() | Domain d4e8gb1: 4e8g B:2-126 [234366] Other proteins in same PDB: d4e8ga2, d4e8ga3, d4e8gb2, d4e8gb3 automated match to d4mggf1 complexed with mg, unl |
PDB Entry: 4e8g (more details), 2 Å
SCOPe Domain Sequences for d4e8gb1:
Sequence, based on SEQRES records: (download)
>d4e8gb1 d.54.1.0 (B:2-126) automated matches {Paracoccus denitrificans [TaxId: 318586]} kiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsha lgaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrva dllgg
>d4e8gb1 d.54.1.0 (B:2-126) automated matches {Paracoccus denitrificans [TaxId: 318586]} kiaeihvyahdlpvkdgpytistvwslqttlvkivadsglagwgetcpvgptyapshalg araalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrvadl lgg
Timeline for d4e8gb1: