Lineage for d4e8ga1 (4e8g A:1-126)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413188Species Paracoccus denitrificans [TaxId:318586] [234364] (1 PDB entry)
  8. 1413189Domain d4e8ga1: 4e8g A:1-126 [234365]
    Other proteins in same PDB: d4e8ga2, d4e8gb2
    automated match to d4mggf1
    complexed with mg, unl

Details for d4e8ga1

PDB Entry: 4e8g (more details), 2 Å

PDB Description: crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4e8ga1:

Sequence, based on SEQRES records: (download)

>d4e8ga1 d.54.1.0 (A:1-126) automated matches {Paracoccus denitrificans [TaxId: 318586]}
mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
adllgg

Sequence, based on observed residues (ATOM records): (download)

>d4e8ga1 d.54.1.0 (A:1-126) automated matches {Paracoccus denitrificans [TaxId: 318586]}
mkiaeihvyahdlslqttlvkivadsglagwgetcpvgptyapshalgaraalaemapgl
iganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrvadllgg

SCOPe Domain Coordinates for d4e8ga1:

Click to download the PDB-style file with coordinates for d4e8ga1.
(The format of our PDB-style files is described here.)

Timeline for d4e8ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e8ga2