Lineage for d4e3ra_ (4e3r A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1868019Species Vibrio fluvialis [TaxId:676] [233050] (3 PDB entries)
  8. 1868020Domain d4e3ra_: 4e3r A: [234357]
    automated match to d4grxa_
    complexed with na, so4; mutant

Details for d4e3ra_

PDB Entry: 4e3r (more details), 1.9 Å

PDB Description: PLP-bound aminotransferase mutant crystal structure from Vibrio fluvialis
PDB Compounds: (A:) Pyruvate transaminase

SCOPe Domain Sequences for d4e3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3ra_ c.67.1.0 (A:) automated matches {Vibrio fluvialis [TaxId: 676]}
nkpqswearaetyslygwtdmpslhqrgtvvvthgegpyivdvngrryldansglfnmva
gfdhkglidaakaqyerfpgyhaafgkmsdqtvmlseklvevspfdsgrvfytnsgsean
dtmvkmlwflhaaegkpqkrkiltrwnayhgatavsasmtgfpynsvfglplpgfvhltc
phywrygeegeteeqfvarlareleetiqregadtiagffaepvmgaggvippakgyfqa
ilpilrkydipvisdevvcgfgrtgntwgcvtydftpdaiissknltagffpmgavilgp
elskrletaieaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeerlk
hiaerpnigeyrgigfmwaleavkdkasktpfdgnlsvseriantctdlglicfplgqsv
vlcppfilteaqmdemfdklekaldkvfaeva

SCOPe Domain Coordinates for d4e3ra_:

Click to download the PDB-style file with coordinates for d4e3ra_.
(The format of our PDB-style files is described here.)

Timeline for d4e3ra_: