SCOPe 2.06: Domain d4e3bb_: 4e3b B:

Lineage for d4e3bb_ (4e3b B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)

8. Domain d4e3bb_: 4e3b B: [234355]
   automated match to d3dj3b_

Details for d4e3bb_

PDB Entry: 4e3b, 1.5 Å

PDB Description: crystal structure of tax-interacting protein-1 (tip-1) pdz domain bound to ical36-l (ansrwptsil) peptide

PDB Compounds: (B:) tax1-binding protein 3

SCOPe Domain Sequences for d4e3bb_:

Sequence; same for both SEQRES and ATOM records:

>d4e3bb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiag
lqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

Timeline for d4e3bb_:

• d4e3bb_ first appeared in SCOPe 2.03
  
• d4e3bb_ appears in SCOPe 2.05
  
• d4e3bb_ appears in SCOPe 2.07
  
• d4e3bb_ appears in the current release, SCOPe 2.08